PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_011813-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family B3
Protein Properties Length: 818aa    MW: 91532.5 Da    PI: 10.3739
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_011813-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B369.54.5e-2235125199
                    EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
             B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                    ffkvl+ ++ +++  l++p +f+++++g+   +kt +l++++g+ W+v++  ++  ++++++kGW++Fvk ++L +gD +vF+++g+s+f  +vk+
  NNU_011813-RA  35 FFKVLIAPNFSRL--LRIPPPFMKHFSGS--VPKTFILRSPTGKLWSVRV--KRIEKQFYFEKGWQRFVKHHRLVAGDLLVFSYHGDSRF--TVKI 122
                    8899977766665..9*******888666..3669***************..**********************************9999..9999 PP

                    E-S CS
             B3  97 frk 99 
                    +++
  NNU_011813-RA 123 YDT 125
                    886 PP

2B347.53.3e-152433261298
                    HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
             B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                    +++ +++pk  ++e g+ +e+  + +l d++grsW+v++ + +++gr  +++GW  F kan++ +gD + F++++  +   +v +fr
  NNU_011813-RA 243 SRSHMMIPKAVTKEVGLTSEG--KAMLWDPRGRSWSVRV-HPRSDGRADISGGWPAFRKANNIVQGDACNFEFIRGPGVVICVNIFR 326
                    45669**********999766..7***************.6788888***************************9888888888888 PP

3B362.66.6e-20404495199
                    EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
             B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                    ffk+  +s+ l++++lv+p kf+++  g+   s+  +l+ +sg++W++ l  +k  g+ +++kGW+eFv+ + L eg ++vF+++g+s f  +v +
  NNU_011813-RA 404 FFKII-HSSILQQRQLVIPEKFVRKLRGN--LSTVAVLTVPSGKVWRIGL--KKVNGKLWFQKGWQEFVEYHSLGEGHVLVFRYEGNSHF--HVLI 492
                    66655.999999**************988..888899999**********..999999****************************9999..***9 PP

                    E-S CS
             B3  97 frk 99 
                    f++
  NNU_011813-RA 493 FDT 495
                    997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.7E-2529127IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.69E-2630128IPR015300DNA-binding pseudobarrel domain
CDDcd100178.22E-2333124No hitNo description
PROSITE profilePS5086314.53633126IPR003340B3 DNA binding domain
SMARTSM010197.4E-2135126IPR003340B3 DNA binding domain
PfamPF023621.4E-1935125IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.6E-17227327IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.12E-16230326IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.661232328IPR003340B3 DNA binding domain
SMARTSM010193.5E-9238328IPR003340B3 DNA binding domain
PfamPF023628.3E-13243326IPR003340B3 DNA binding domain
CDDcd100171.22E-13243326No hitNo description
SuperFamilySSF1019366.08E-25401495IPR015300DNA-binding pseudobarrel domain
CDDcd100171.76E-23402494No hitNo description
Gene3DG3DSA:2.40.330.102.1E-26403496IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086315.03403496IPR003340B3 DNA binding domain
SMARTSM010194.3E-20404496IPR003340B3 DNA binding domain
PfamPF023624.4E-17404495IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.0E-8652724IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-7653724IPR015300DNA-binding pseudobarrel domain
CDDcd100171.70E-7658724No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009909Biological Processregulation of flower development
GO:0010048Biological Processvernalization response
GO:0005654Cellular Componentnucleoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 818 aa     Download sequence    Send to blast
MVEMPPVTKK LRQPRPIAET KIRRMTSHRR NRPSFFKVLI APNFSRLLRI PPPFMKHFSG  60
SVPKTFILRS PTGKLWSVRV KRIEKQFYFE KGWQRFVKHH RLVAGDLLVF SYHGDSRFTV  120
KIYDTSSCEK ELPFLLSSSS AQTTTSTQSG QSNLRPKNKK QGKTKTESTT KAIVSTSKGN  180
GDEFFFSTIL TVVIHATLLI FMIYMDAVGR ATPRRQPRNE AIKAASSYKT EFPQFASLCG  240
KTSRSHMMIP KAVTKEVGLT SEGKAMLWDP RGRSWSVRVH PRSDGRADIS GGWPAFRKAN  300
NIVQGDACNF EFIRGPGVVI CVNIFREAAG FGELAHFSNQ IPRAPPPSTA TVLKALPCIT  360
EEDVSETDAG GWSSYTLAET MNRRRSCQDS SDVSSISWVK SFHFFKIIHS SILQQRQLVI  420
PEKFVRKLRG NLSTVAVLTV PSGKVWRIGL KKVNGKLWFQ KGWQEFVEYH SLGEGHVLVF  480
RYEGNSHFHV LIFDTTASEI EYPCDHTENH LETSLIPCKV KEEILQEDSL EILDVFPPSL  540
GNPASLATPS SKGVIKERLE DQCTTRGRRE NHPRWSRKSE PSCGTKNHGN GNPHPQASST  600
PSVGHKGMHG FAETEKKSAI TSGTKRRPDS RAFATRGLTI QERSRVGKAA RAFKSKNPFV  660
SVIMRPSYVG GGGRGCSLDL PMEFCRIYLT EEMQRNIKME DSDGRSWSAR LFFEGNGAVR  720
ICKGEVPHVN TVGVFNALRK NKKGSSFGVV DDEPRLAEQV AVEVIHIDID NVKERLKDVP  780
RRGNTESVNS EVHLAEQVPI APSTEMDDTS GPFIGVGE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010263798.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X1
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.14e-45B3 family protein